PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc08_g10440
Common NameGSCOC_T00027011001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family TALE
Protein Properties Length: 557aa    MW: 62160.9 Da    PI: 5.7877
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc08_g10440genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36.3e-094755131854
                  HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  +F++  ++yp+ +e+  LA+k gLt +qV++WF N R +
  Cc08_g10440 475 MFQNflHPYPKDAEKHLLAMKSGLTRSQVSNWFINARVR 513
                  5887779******************************88 PP

2BELL735e-24349416472
         BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  + ++kk +Ll lle Vd+rY+ + ++++tvis+F+av++l++  +++++Al++iS  +++L+++i+++i
  Cc08_g10440 349 NAERKKKQLLGLLEAVDDRYNECLDEIHTVISAFHAVTELDP-PIHARFALQTISILYKNLRERISNHI 416
                  5689**************************************.9**********************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.3E-19264414IPR006563POX domain
PfamPF075262.2E-25270413IPR006563POX domain
PROSITE profilePS5007111.272454517IPR001356Homeobox domain
CDDcd000863.81E-11457518No hitNo description
SMARTSM003896.2E-6457521IPR001356Homeobox domain
SuperFamilySSF466891.67E-15459526IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-26460523IPR009057Homeodomain-like
PfamPF059207.3E-15474513IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MTEPSSGNPF DANFLSSSEL IVLNNRDRIL SGIPGPSVVQ GDGTSSQAWI HEPNSGRISD  60
SYMLRNMLPE REPMGVVPYG ASHQISSTQV QDRYMEGMPL SAASIATLLA ARSDNQENLE  120
KPVSSAPLIY PLEIPRSIVL NDNADNLNPS HSSMRYGYDE LAGAAVGRIG LQPFESMMNL  180
YPNEWITSEN ANLDSDSPSG CSRLSNELSL SLAMTNPSVV HRTSIQDQCS EICGSSSPCE  240
RCLGSEQTSC NRNLSLGFGS YRPVQLSQFL SGSRYIHVMQ ELLAEIAAYS LGSLDLMKSP  300
AIGMEDRADA SISSSCTAVE GYLSAASEDF SDASNIVRYQ IDPVLPGRNA ERKKKQLLGL  360
LEAVDDRYNE CLDEIHTVIS AFHAVTELDP PIHARFALQT ISILYKNLRE RISNHILAMG  420
AHLSQGVVRE NEESFEASFI QKQWALQQLK RKDNQLWRPQ RGLPERSVSV LRAWMFQNFL  480
HPYPKDAEKH LLAMKSGLTR SQVSNWFINA RVRLWKPMIE EMYSEMNRRK IRHNDEETNS  540
NQRSRVSVEN GRFSMY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A5e-15463521563Homeobox protein Meis2
4xrm_B5e-15463521563Homeobox protein Meis2
4xrs_A5e-15463520158Homeobox protein Meis1
4xrs_B5e-15463520158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361000.20.0PREDICTED: homeobox protein ATH1
SwissprotP487311e-103ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A068UKX60.0A0A068UKX6_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000769950.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-104homeobox gene 1